LL-37: The Human Body's Only Antimicrobial Peptide — Complete Research Guide 2026

LL-37 belongs to a family of antimicrobial peptides called cathelicidins — peptides characterized by a conserved N-terminal "cathelin" domain and a variable C-terminal antimicrobial region. Mammals produce numerous cathelicidins: pigs make protegrins, rabbits make CRAMP, cows make indolicidins. Humans produce exactly one: LL-37. ^[1]

The name comes from its structure: it begins with two leucine (L) residues and contains 37 amino acids total ([LL-37, 37 aa]). It carries a net positive charge of +6 at physiological pH, which is not cosmetic — that charge is the key to its antimicrobial mechanism. ^[2]

LL-37 is not stored pre-formed in the body. It is cleaved from a larger precursor protein called hCAP18 (human cationic antimicrobial protein 18 kDa) by the serine protease kallikrein-5, which activates on immune stimulus. The production sites include:

• Neutrophil granules — released on degranulation at infection sites
• Epithelial cells — skin, respiratory tract, gut epithelium, urogenital tract
• Bone marrow cells and monocytes/macrophages
• Platelets — contributing to its wound repair role

In healthy skin, LL-37 is constitutively expressed at low levels and dramatically upregulated during wounding, infection, or inflammation. The skin of atopic dermatitis patients paradoxically shows reduced LL-37, which partly explains their susceptibility to Staphylococcus aureus infection — a finding with direct implications for therapeutic research. ^[3]

LL-37 is not a one-trick antimicrobial. It operates across four distinct biological systems simultaneously, which is precisely what makes it so compelling as a research subject — and so complex to study clinically.

1. Direct Membrane Disruption

LL-37 adopts an amphipathic alpha-helical structure when it contacts microbial membranes. Its positively charged face is electrostatically attracted to the negatively charged phospholipids on bacterial surfaces (gram-positive: teichoic acids; gram-negative: lipopolysaccharide). It then intercalates into the membrane bilayer and creates pores or disrupts membrane integrity via the "carpet model," causing lethal depolarization and ion leakage. ^[2]

This mechanism confers broad-spectrum activity because it targets a structural feature conserved across diverse microorganisms — not a protein that can easily mutate to resist. Resistance to LL-37 is possible but energetically costly for bacteria, which may explain why clinical resistance remains low despite its constitutive presence. ^[4]

2. Viral Defense via Envelope Disruption and Receptor Blocking

LL-37 disrupts enveloped viruses (HSV-1, vaccinia, influenza, RSV) through similar membrane-targeting. But its antiviral mechanism also extends to direct receptor blocking. In 2025, published research in Frontiers in Cellular and Infection Microbiology confirmed that LL-37 binds the SARS-CoV-2 spike glycoprotein, specifically at the receptor-binding domain and the accessory proteins ORF7a and ORF8 — potentially blocking viral entry into ACE2-expressing cells. ^[5]

3. Immune Modulation: The Rheostat Function

LL-37 acts as a bidirectional immune modulator — its effect depends entirely on concentration and cellular context. At low concentrations, it exhibits anti-inflammatory activity by inhibiting LPS-induced TLR4 signaling. At high concentrations, it drives pro-inflammatory cytokine release and activates dendritic cells, bridging innate and adaptive immunity. It also chemotacts neutrophils, monocytes, and T cells via the FPRL1 (formyl peptide receptor-like 1) receptor and acts as an alarmin, signaling danger to surrounding immune cells. ^[6]

4. Wound Repair via Growth Factor Signaling

LL-37 directly stimulates re-epithelialization and angiogenesis — critical wound repair steps. It activates EGFR (epidermal growth factor receptor) and transactivates growth factor signaling cascades, promoting keratinocyte migration and proliferation. It also stimulates VEGF (vascular endothelial growth factor) expression, driving new blood vessel formation into the wound bed. ^[7]

The strongest human clinical data for LL-37 comes from wound-healing studies, where the compound has progressed further than in any other indication. Researchers have completed trials across two wound types: venous leg ulcers and diabetic foot ulcers.

Venous Leg Ulcer Trial (Agerberth et al.)

In the landmark venous leg ulcer trial (n=34), participants received twice-weekly topical doses of 0.5, 1.6, or 3.2 mg/mL LL-37 or placebo over 4 weeks. The most striking finding was an inverted dose-response relationship: lower doses outperformed the highest dose. ^[8]

• 0.5 mg/mL group: 68% ulcer size reduction from baseline
• 1.6 mg/mL group: 50% ulcer size reduction with mean wound area decrease of 5.29 cm²
• 3.2 mg/mL group: No significant difference versus placebo

The inverted dose-response matters mechanistically: at higher concentrations LL-37's pro-inflammatory properties may counteract its healing-promoting effects — consistent with its known concentration-dependent immune modulation. This has significant implications for clinical dosing design. ^[8]

Diabetic Foot Ulcer RCT (NCT04098562)

A randomized double-blind controlled trial registered at ClinicalTrials.gov (NCT04098562) examined LL-37 cream for diabetic foot ulcers. Published in 2023, this study demonstrated that topical LL-37 significantly increased granulation tissue formation versus placebo — a key wound-healing endpoint indicating tissue repair activity. The trial enrolled patients with Wagner Grade 1-2 diabetic foot ulcers unresponsive to standard of care. ^[9]

Phase IIb Multi-Center Trial

The most statistically powered wound trial — a Phase IIb RCT enrolling 148 patients — found complete wound closure in 28.1% of LL-37-treated patients versus 8.1% on placebo within the large-wound subgroup, a clinically and statistically significant outcome. ^[10]

One of the most clinically actionable findings in LL-37 research is its direct dependence on vitamin D. The landmark 2006 study by Liu et al. in Science demonstrated that TLR1/2 activation of human macrophages triggers upregulation of the vitamin D receptor (VDR) and CYP27B1, the enzyme that converts 25-hydroxyvitamin D to its active form. Active vitamin D then directly drives LL-37 gene expression. ^[11]

The implications are clinically significant:

• Vitamin D deficiency = reduced LL-37 production — directly impairing innate immune capacity
• Vitamin D sufficiency (≥40 ng/mL) correlates with stronger antimicrobial response in observational data
• The vitamin D → LL-37 pathway may partly explain seasonal respiratory infection patterns, including influenza seasonality, which correlates inversely with solar UV exposure
• Tuberculosis patients with low vitamin D show reduced LL-37 expression in alveolar macrophages — a mechanistic link to TB susceptibility in low-sunlight populations ^[12]

For researchers studying immune function, this creates an interesting synergy hypothesis: vitamin D status as a critical cofactor for LL-37 bioavailability. Researchers working with LL-37 as an exogenous compound should be aware that endogenous production levels vary significantly based on subject vitamin D status, a potential confounding variable in study design. ^[11]

The COVID-19 pandemic redirected significant research attention toward LL-37's antiviral properties. Multiple independent groups noted the epidemiological correlation between geographic vitamin D deficiency and severe COVID-19 outcomes, with LL-37's vitamin D dependence providing a plausible mechanistic link.

In vitro studies demonstrated that LL-37 inhibits SARS-CoV-2 replication in Vero cells. The 2025 study published in Frontiers in Cellular and Infection Microbiology provided the most specific molecular evidence to date: LL-37 directly binds the SARS-CoV-2 spike glycoprotein — including the receptor-binding domain — and also interacts with accessory proteins ORF7a and ORF8, which are known immune evasion factors. ^[5]

This doesn't mean LL-37 is a COVID treatment — the gap between in vitro binding data and clinical efficacy is substantial, and direct translation is far from established. What it does suggest is that LL-37's antiviral scope extends beyond membrane disruption to receptor-level interference with at least one clinically relevant pandemic pathogen. ^[5]

The broader antiviral record includes documented activity against:

• HSV-1 and HSV-2 (herpes simplex)
• Influenza A (membrane disruption)
• RSV (respiratory syncytial virus)
• Vaccinia virus
• HIV — reduced virion infectivity at experimental concentrations

LL-37 has a complex safety profile that every serious researcher must understand. Several key considerations apply:

The Psoriasis Paradox

LL-37 plays a causative role in psoriasis pathogenesis. In psoriatic skin, LL-37 forms complexes with self-DNA released from damaged keratinocytes. These complexes activate plasmacytoid dendritic cells (pDCs) via TLR9, triggering a massive type I interferon response that initiates the psoriatic inflammatory cascade. ^[13] For researchers with psoriasis, rosacea, or lupus, exogenous LL-37 may worsen autoimmune symptoms — this is not a theoretical concern but a mechanistically established pathway.

Cytotoxicity Threshold

LL-37 shows cytotoxicity toward mammalian cells at concentrations modestly above its antimicrobial effective range. The therapeutic window is narrow — concentrations that kill bacteria are not far from concentrations that damage host cells. This window narrows further in inflamed tissue where local concentrations may be unpredictable. The inverted dose-response in clinical wound trials (described above) likely reflects this ceiling. ^[4]

Proteolytic Instability

LL-37 is rapidly degraded by serine proteases abundant in wound exudate and blood. Its half-life in biological fluids is short, which significantly limits systemic injection applications and explains why topical delivery (directly to the wound site) has been the dominant clinical approach. ^[2] Next-generation LL-37 analogs with modified amino acids are in development specifically to address this instability.

Production Cost

LL-37 is expensive to synthesize in pharmaceutical quantities — it is a 37-residue peptide with complex secondary structure requirements. This has historically slowed commercial trial development and contributes to the higher per-milligram cost compared to shorter research peptides.

No FDA-approved dosing exists for LL-37. The following represents descriptions from published research literature and observational clinical data — not therapeutic guidelines or recommendations. All LL-37 is available strictly as a research compound for laboratory use only.

The clinical wound-healing trial data provides the most controlled dosing reference:

• Topical application: 0.5 mg/mL to 1.6 mg/mL in cream or gel formulation, applied twice weekly directly to wound bed (optimal in venous leg ulcer data)
• Subcutaneous injection research protocols describe 100–200 mcg/day in rodent models; extrapolation to human research settings should be treated as preliminary and highly speculative
• Injection cycling described in some research literature: 5 days on / 2 days off, in 2–4 week study cycles

The most meaningful clinical data comes from topical administration directly to wound sites — this is where mechanism, delivery, and human evidence align most coherently. Systemic injectable research is far less developed and faces the proteolytic stability challenge described above. ^[8][9]

LL-37 is available as a research compound from several USA-based vendors with third-party COA documentation. Because it is a 37-residue peptide, synthesis complexity means purity verification is particularly important — HPLC mass-spectrometry confirmation is the minimum standard for reputable supply. The vendors below are among the most cited in the research peptide community for quality and documentation standards.

Researchers studying immune function often compare LL-37 to other immune-modulating peptides. Here's how LL-37's research profile differs from the most commonly studied immune peptides:

• vs. Thymosin Alpha-1 (Tα1): Tα1 is primarily immunostimulatory — it enhances T-cell function and dendritic cell maturation. LL-37 operates further upstream in innate immunity and has direct antimicrobial killing capacity that Tα1 lacks. They work on different mechanisms and are not interchangeable.
• vs. KPV (Tripeptide): KPV is a 3-amino acid anti-inflammatory peptide with gut-specific evidence. LL-37 is 37 amino acids with broad-spectrum antimicrobial action. KPV is anti-inflammatory by design; LL-37's immune modulation is bidirectional and context-dependent.
• vs. BPC-157: BPC-157 promotes tissue healing through growth factor signaling and angiogenesis. LL-37 shares the angiogenesis signal (VEGF) but adds direct antimicrobial killing — making LL-37 theoretically more relevant to infected wounds where BPC-157 alone doesn't address pathogen burden.
• vs. GHK-Cu: GHK-Cu (copper tripeptide) is the leading skin and anti-aging peptide with 1,000%+ search growth in 2026. GHK-Cu and LL-37 are complementary — GHK-Cu drives collagen remodeling while LL-37 handles microbial control. Some researchers study them in combination for wound applications. See our GHK-Cu Complete Guide.

LL-37 sits at a genuinely unique intersection in peptide research: it is not a synthetic compound designed by pharmaceutical chemists but the body's own evolutionary solution to microbial invasion — a 37-amino-acid peptide that has persisted in humans for millions of years because it works. Its mechanism is mechanistically distinct from antibiotic drugs (targeting membrane structure rather than specific bacterial proteins), its immune-modulatory properties bridge innate and adaptive immunity in ways no small molecule can, and its wound-healing clinical trial data is among the strongest in the research peptide space.

The cautions are real. The psoriasis paradox — LL-37 as both an antimicrobial peptide and a pathogenic trigger in autoimmune skin disease — illustrates the danger of treating any biological molecule as unconditionally beneficial. The cytotoxicity window is narrow. The proteolytic instability limits systemic application. And none of its applications have reached Phase III trials or regulatory approval for human use. ^[4][13]

For researchers studying immune function, wound repair, or antimicrobial peptide biology, however, LL-37 is arguably the single most important human AMP to understand. The vitamin D connection alone makes it practically relevant to virtually every immunology research project. The SARS-CoV-2 spike binding data published in 2025 adds a compelling new antiviral research angle. And the completed wound-healing trials provide a foundation for the next generation of clinical work. ^[5][10]

Continue exploring: Thymosin Alpha-1 Complete Guide | GHK-Cu Anti-Aging Guide | BPC-157 Complete Guide | KPV Anti-Inflammatory Guide